Connect with us

feautured

Μη χτυπάς μια πόρτα που είναι για σένα κλειστή.

Published

on

Μοιραστείτε το με τους φίλους σας

Της Γεωργίας Ανδριώτου.

Τον πάλεψες αυτόν τον έρωτα. Με όλα τα μέσα της καρδιάς σου.

Του έδωσες ευκαιρίες, του έδωσες άλλοθι. Γιατί ήταν ο έρωτας που είχες επιλέξει.

Ο έρωτας που ήταν για σένα καρδιοχτύπι, ενθουσιασμός και πάθος.

Ο έρωτας που ήρθε για να ανατρέψει τα δεδομένα σου, να γίνει προτεραιότητά σου, να διεκδικήσει τις στιγμές σου.

Δεν ήταν, όμως, αμοιβαίος. Δυστυχώς για σένα τα συναισθήματά σου δεν βρήκαν το αντίκρισμα που τόσο λαχταρούσες και ονειρευόσουν.

Το διαισθανόσουν από την αρχή, αλλά η καρδιά σου είχε αποφασίσει να μην ακούσει τη λογική. Κι αποφάσισες να τον διεκδικήσεις. Με όποιο κόστος.

Ήταν πολλές οι φορές που του ψιθύρισες λόγια τρυφερά κάτω από τα κλειστά παραθυρόφυλλά του. Που περίμενες για την ανταπόκριση που μόνο σε έναν έρωτα ταιριάζει. Την απόλυτη.

Η πόρτα αυτού του έρωτα όμως, μάτια μου, ήταν κλειστή για σένα. Κι εσύ επέμενες να την χτυπάς. Έσερνες την αξιοπρέπειά σου μπροστά στο χαλάκι της για να την ξαποστάσεις.

Πότε μισο-άνοιγε για να σου δώσει λίγες τζούρες χαράς κι πότε έκλεινε ερμητικά στα μούτρα σου. Ποτέ, όμως, δεν άνοιξε διάπλατα για σένα. Για να σε αγκαλιάσει. Για να σε διεκδικήσει. Για να κανακέψει την κουρασμένη σου καρδιά.

Γι’ αυτό μην την ταλαιπωρείς άλλο την καρδιά σου. Μη χτυπάς μια πόρτα που είναι για σένα κλειστή. Μια πόρτα που την έχουν πια κλειδώσει κι έχουν πετάξει το κλειδί. Δεν αξίζει να ξεπέφτεις άλλο στα δικά σου μάτια.

Ο έρωτας πρέπει να σε απογειώνει. Να καρφιτσώνει χαμόγελα στο βλέμμα σου. Να κάνει λάβαρο την καρδιά για να σε κατακτήσει. Δεν τον παρακαλάς. Όταν τον ικετεύεις, παύει να είναι έρωτας. Είναι μια ταλαιπώρια μάταιη.

Σταμάτα να χτυπάς άλλο να σου ανοίξουν.  Ο έρωτας σου έπαψε πια να κατοικεί εκεί που τον αναζητάς. Κι αυτό είναι μια σκληρή, αλλά και απαραίτητη παραδοχή για να μπορέσεις να προχωρήσεις παρακάτω στη ζωή σου. Της το χρωστάς.

Το χρωστάς στον εαυτό σου.\

αναπνοές

Γεωργία Ανδριώτου

Νησιώτισσα στην καταγωγή και έμπνευσή μου η θάλασσα. Δασκάλα σ' ένα μικρό δημοτικό, παιδεύομαι και παιδεύω να σμιλέψω το παιδί με το δικό του φως και τη δική μου γνώση. Μέσα σε μια μικρή τάξη έμαθα να παρατηρώ βλέμματα και χαμόγελα, ν' ακούω και να ερμηνεύω λέξεις και φωνές. Ώσπου αυθόρμητα κι αυτόματα πια άρχισα να παρατηρώ και να ερμηνεύω την ανθρώπινη συμπεριφορά των ενηλίκων του κόσμου γύρω μου. Κι όσα η ματιά και η διαίσθησή μου καταγράφει, παλεύουν να γίνουν λέξεις στο χαρτί...λέξεις και συναίσθημα...

View All Posts
What’s your Reaction?
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0

Μοιραστείτε το με τους φίλους σας
Advertisement
242 Comments

242 Comments

  1. Kristine

    5 October 2021 at 2:00 am

    hi!,I like your writing very so much! proportion we keep up a correspondence more approximately your
    article on AOL? I require a specialist in this house to resolve my problem.
    May be that’s you! Taking a look ahead to
    see you.

  2. best skin

    5 October 2021 at 2:09 am

    I was suggested this web site by my cousin. I’m not
    sure whether this post is written by him as no one else know such detailed about my problem.
    You’re wonderful! Thanks!

    Feel free to visit my blog post – best skin

  3. Brandie

    5 October 2021 at 2:10 am

    Hello my friend! I wish to say that this post is awesome,
    nice written and include almost all significant infos.
    I’d like to peer extra posts like this .

  4. I got what you mean,saved to my bookmarks, very nice internet site.

    Here is my blog post :: http://39.98.110.214/forum.php?mod=viewthread&tid=915829

  5. various cannabis

    5 October 2021 at 2:32 am

    Good site you have here.. It’s difficult to find quality writing like yours nowadays.
    I really appreciate people like you! Take care!!

    Also visit my web page various cannabis

  6. ketosis diets

    5 October 2021 at 2:34 am

    First off I want to say great blog! I had a
    quick question in which I’d like to ask if you don’t mind.
    I was curious to find out how you center yourself and clear your head prior to writing.
    I’ve had a tough time clearing my mind in getting
    my ideas out there. I truly do take pleasure in writing however it just seems like the first 10 to 15 minutes tend to be lost simply just trying to figure out how to begin. Any
    recommendations or tips? Cheers!

    Also visit my homepage; ketosis diets

  7. gain weight

    5 October 2021 at 2:36 am

    It’s really a cool and useful piece of info. I’m glad that you just shared
    this useful info with us. Please keep us informed like
    this. Thank you for sharing.

    Here is my page: gain weight

  8. sexual pleasure

    5 October 2021 at 2:38 am

    As a Newbie, I am permanently browsing online for articles that can aid me.
    Thank you

    Here is my homepage sexual pleasure

  9. Carole

    5 October 2021 at 2:40 am

    I do not know whether it’s just me or if perhaps everybody else encountering
    issues with your blog. It appears as if some of the written text within your posts are running off the screen. Can somebody
    else please comment and let me know if this is happening to them too?
    This may be a issue with my web browser because I’ve had this happen previously.
    Cheers

  10. I am in fact pleased to glance at this website posts which includes plenty of useful facts,
    thanks ketogenic diet for weight loss (http://www.fles.hlc.edu.tw/userinfo.php?uid=1374471) providing these data.

  11. quit smoking

    5 October 2021 at 2:55 am

    Hi there, I enjoy reading all of your article post. I wanted to write
    a little comment to support you.

    Feel free to surf to my site – quit smoking

  12. wrinkle skin care

    5 October 2021 at 2:55 am

    Hurrah! After all I got a web site from where I can in fact obtain useful facts regarding my study and knowledge.

    my page: wrinkle skin care

  13. drug abuse treatment

    5 October 2021 at 3:04 am

    Appreciate it for this post, I am a big fan of this web site would like to
    go on updated.

    My webpage :: drug abuse treatment

  14. My brother suggested I might like this web site.
    He was entirely right. This post truly made my day.
    You can not imagine just how much time I had spent for this info!
    Thanks!

    Look into my blog post; http://163.30.42.16/~health2017/userinfo.php?uid=5263235

  15. hemp seed oil uses

    5 October 2021 at 3:10 am

    You got a very wonderful website, Gladiolus I discovered
    it through yahoo.

    Feel free to visit my web blog: hemp seed oil uses

  16. organic and natural skin care

    5 October 2021 at 3:12 am

    always i used to read smaller articles or reviews which as well clear their motive, organic and natural skin care that is also happening with this piece of
    writing which I am reading at this time.

  17. http://163.30.42.16/

    5 October 2021 at 3:16 am

    I am so happy to read this. This is the type of manual easy diets that work (http://163.30.42.16/) needs to be given and not the accidental misinformation that’s at the other blogs.

    Appreciate your sharing this best doc.

  18. diet plan includes

    5 October 2021 at 3:23 am

    Thank you for every other informative blog. The place else may just I get that
    type of info written in such a perfect means? I have a project that I am simply now working on, and I’ve been on the
    look out for such info.

    Here is my web site diet plan includes

  19. sex advice

    5 October 2021 at 3:27 am

    Some truly wonderful info, Sword lily I discovered this.

    My web-site :: sex advice

  20. testosterone naturally

    5 October 2021 at 3:29 am

    Some genuinely good info, Sword lily I discovered this.

    My blog post; testosterone naturally

  21. hormone levels

    5 October 2021 at 3:33 am

    Hey! I just wanted to ask if you ever have any trouble
    with hackers? My last blog (wordpress) was hacked and I ended up losing several weeks of hard work
    due to no data backup. Do you have any methods to stop hackers?

    Also visit my web blog … hormone levels

  22. ketogenic diets

    5 October 2021 at 3:33 am

    If you would like to grow your knowledge simply keep visiting
    this web site and be updated with the hottest gossip
    posted here.

    Here is my web site ketogenic diets

  23. calories eating

    5 October 2021 at 3:34 am

    Fine way of explaining, and fastidious article to get information on the
    topic of my presentation subject, which i am going to deliver in school.

    Also visit my site :: calories eating

  24. omega 3 fatty acids

    5 October 2021 at 3:34 am

    Hey excellent blog! Does running a blog like this require
    a massive amount work? I have absolutely no expertise in computer programming however I was hoping to start my own blog
    in the near future. Anyway, if you have any ideas or techniques for new blog owners please share.

    I understand this is off subject nevertheless
    I just had to ask. Kudos!

    Also visit my web-site … omega 3 fatty acids

  25. eating plan

    5 October 2021 at 3:44 am

    What’s up, this weekend is fastidious in support of me, for the reason that this time i am reading
    this great educational paragraph here at my residence.

    Here is my web page: eating plan

  26. cleveland clinic diet

    5 October 2021 at 3:51 am

    Hi, Neat post. There’s a problem together with your website
    in internet explorer, could check this? IE still is
    the marketplace leader and a big portion of people will miss your fantastic writing because
    of this problem.

    Look into my homepage :: cleveland clinic diet

  27. low carb

    5 October 2021 at 3:53 am

    Tremendous things here. I’m very glad to peer your post.
    Thanks so much and I’m having a look forward to touch you.

    Will you please drop me a mail?

    Review my blog :: low carb

  28. best low carb diet

    5 October 2021 at 4:02 am

    Greate pieces. Keep posting such kind of information on your
    page. Im really impressed by your site.[X-N-E-W-L-I-N-S-P-I-N-X]Hello there, You have done an incredible job.

    I will definitely digg it and in my view recommend to my friends.
    I am sure they will be benefited from this site.

    Feel free to surf to my web page … best low carb diet

  29. eat healthy foods

    5 October 2021 at 4:06 am

    My brother suggested I may like this blog. He was once totally right.
    This post actually made my day. You cann’t imagine simply how much time I had spent for this
    information! Thank you!

    my website eat healthy foods

  30. five diets

    5 October 2021 at 4:08 am

    Tremendous things here. I’m very happy to see your post.
    Thanks a lot and I’m looking forward to contact you. Will you please
    drop me a e-mail?

    My blog post :: five diets

  31. teens smoking

    5 October 2021 at 4:13 am

    We wish to thank you yet again for the stunning ideas you gave Jesse when preparing
    her own post-graduate research plus, most importantly, for providing all of the ideas in a blog post.
    Provided that we had been aware of your web site a year
    ago, we would have been rescued from the nonessential measures we
    were employing. Thanks to you.

    Review my blog post; teens smoking

  32. pubic hair removal

    5 October 2021 at 4:13 am

    Excellent post. Keep writing such kind of info on your site.
    Im really impressed by your blog.[X-N-E-W-L-I-N-S-P-I-N-X]Hi there,
    You have performed an excellent job. I’ll definitely digg it and in my opinion recommend
    to my friends. I’m sure they’ll be benefited from this site.

    Visit my page :: pubic hair removal

  33. http://www.fles.hlc.edu.tw/

    5 October 2021 at 4:18 am

    I have been checking out some of your stories and i must say clever stuff.
    I will make sure how to spice up your sex life [http://www.fles.hlc.edu.tw/] bookmark your blog.

  34. eating healthy allows

    5 October 2021 at 4:22 am

    you are in point of fact a good webmaster. The site loading velocity is amazing.
    It seems that you’re doing any unique trick.
    In addition, The contents are masterwork. you’ve performed a fantastic task
    on this matter!

    Also visit my blog … eating healthy allows

  35. guaji333.com

    5 October 2021 at 4:24 am

    I am constantly thought about this, thanks for posting.

    Here is my page – guaji333.com

  36. www.cruzenews.com

    5 October 2021 at 4:26 am

    I am really impressed along with your writing talents and also with the structure for your blog.
    Is that this a paid topic or did you modify it yourself?
    Anyway stay up the excellent high quality writing, it is rare to peer a great blog like this one nowadays.

    my site … diabetic diet, http://www.cruzenews.com,

  37. ckd diet

    5 October 2021 at 4:32 am

    Thank you a lot for sharing this with all of us you actually understand what you are speaking approximately!
    Bookmarked. Please additionally consult with my website =).
    We may have a hyperlink alternate agreement between us!

    Have a look at my blog post – ckd diet

  38. www.fotosombra.com.br

    5 October 2021 at 4:34 am

    Outstanding quest there. What happened after?
    Good luck!

    Feel free to visit my web-site fast weight loss – http://www.fotosombra.com.br

  39. stop smoking weed everyday

    5 October 2021 at 4:44 am

    First off I want to say excellent blog! I had a quick question in which I’d like to ask if you
    do not mind. I was interested to know how you center yourself and clear your thoughts before writing.

    I have had a tough time clearing my thoughts in getting
    my thoughts out. I truly do take pleasure
    in writing but it just seems like the first 10 to 15 minutes are usually wasted simply just trying to figure
    out how to begin. Any ideas or hints? Cheers!

    Review my webpage stop smoking weed everyday

  40. Gita

    5 October 2021 at 4:44 am

    I really appreciate this post. I have been looking everywhere for this!

    Thank goodness I found it on Bing. You have made my day!

    Thanks again!

    Also visit my homepage Gita

  41. Blondell

    5 October 2021 at 4:54 am

    Great blog here! Also your web site loads up fast!
    What host are you using? Can I get your affiliate link to your host?
    I wish my website loaded up as fast as yours lol

  42. diet solution program

    5 October 2021 at 4:59 am

    Hello.This article was really fascinating, especially since I was
    browsing for thoughts on this matter last Sunday.

    Feel free to surf to my web page; diet solution program

  43. lovemaking ideas

    5 October 2021 at 4:59 am

    Wonderful goods from you, man. I have understand
    your stuff previous to and you’re just extremely wonderful.

    I really like what you’ve acquired here, certainly like what you are saying and the way in which you say
    it. You make it enjoyable and you still care for to keep it smart.
    I can not wait to read far more from you. This is really a terrific web site.

    Stop by my web page – lovemaking ideas

  44. find easy diets

    5 October 2021 at 5:00 am

    Ahaa, its good discussion concerning this article at this place
    at this webpage, I have read all that, so now me also commenting here.

    Also visit my homepage :: find easy diets

  45. www.fles.hlc.edu.tw

    5 October 2021 at 5:10 am

    Because the admin of this web page is working, no uncertainty
    very soon it will be well-known, due to its feature contents.

    Also visit my blog post: facial skin care routine – http://www.fles.hlc.edu.tw

  46. skilled drug crime

    5 October 2021 at 5:17 am

    I believe this is among the so much significant information for me.
    And i’m happy reading your article. But wanna
    commentary on few general issues, The website style is great, the articles
    is really nice : D. Just right process, cheers

    Check out my blog: skilled drug crime

  47. healthy eating cookbook

    5 October 2021 at 5:19 am

    whoah this weblog is great i love reading your articles.
    Stay up the great work! You already know, many people are hunting round for this info, you could
    help them greatly.

    My web site … healthy eating cookbook

  48. fat burning kitchen

    5 October 2021 at 5:21 am

    You are a very intelligent person!

    Feel free to visit my website: fat burning kitchen

  49. skin care chemical

    5 October 2021 at 5:28 am

    bookmarked!!, I love your site!

    My blog – skin care chemical

  50. omega 3 fatty acids

    5 October 2021 at 5:31 am

    Why visitors still make use of to read news papers when in this
    technological world everything is accessible on net?

    Here is my web blog; omega 3 fatty acids

  51. diet ulitmate

    5 October 2021 at 5:38 am

    We are a group of volunteers and starting a new scheme in our community.
    Your website provided us with valuable information to
    work on. You have done an impressive job and our entire
    community will be thankful to you.

    Also visit my site – diet ulitmate

  52. how to please a man

    5 October 2021 at 5:39 am

    I like this weblog very much, Its a rattling nice situation how to please a man read and receive
    information.

  53. brace company near crest hill

    5 October 2021 at 5:45 am

    Excellent job once again. Thumbs up.

    Here is my page … brace company near crest hill

  54. Tayla

    5 October 2021 at 5:46 am

    I just could not go away your site before suggesting
    that I really loved the standard information a person provide
    to your guests? Is gonna be back frequently in order
    to investigate cross-check new posts

  55. http://39.98.110.214

    5 October 2021 at 5:52 am

    I?m amazed, I must say. Seldom do I encounter a blog that?s both educative and amusing, and let
    me tell you, you’ve hit the nail on the head. The problem is something not enough people are speaking intelligently about.
    Now i’m very happy that I stumbled across this during my search for something relating to
    this.

    Check out my site: http://39.98.110.214

  56. cannabis doctors

    5 October 2021 at 5:58 am

    Great article, just what I was looking for.

    My webpage :: cannabis doctors

  57. houston getting treatment

    5 October 2021 at 6:03 am

    Wow, this post is good, my sister is analyzing these kinds of
    things, thus I am going to inform her.

    Also visit my webpage … houston getting treatment

  58. marijuana seeds

    5 October 2021 at 6:04 am

    Wow, this piece of writing is nice, my sister is analyzing these kinds of things,
    so I am going to tell her.

    Also visit my homepage: marijuana seeds

  59. skin care tip

    5 October 2021 at 6:06 am

    I do consider all of the concepts you’ve introduced to
    your post. They’re really convincing and can definitely work.
    Still, the posts are too brief for novices. May just you please prolong
    them a little from subsequent time? Thanks for the post.

    Look at my site: skin care tip

  60. oily skin

    5 October 2021 at 6:16 am

    Glad to be one of the visitors on this awesome
    site :D.

    Feel free to surf to my site … oily skin

  61. natural testosterone levels

    5 October 2021 at 6:21 am

    As a Newbie, I am permanently browsing online for articles that can help me.
    Thank you

    Here is my web page – natural testosterone levels

  62. skin care p

    5 October 2021 at 6:23 am

    Thanks for every one of your effort on this website. My aunt enjoys
    getting into investigation and it’s easy to understand why.
    Most of us learn all relating to the compelling
    ways you make worthwhile information via your web blog and as well foster contribution from other individuals on that theme then our favorite
    girl is learning a lot of things. Take advantage of the rest of the new year.

    You are always conducting a very good job.[X-N-E-W-L-I-N-S-skin care p-I-N-X]I am
    extremely inspired along with your writing skills and also with the format for your weblog.
    Is that this a paid subject or did you customize it your
    self? Anyway stay up the excellent high quality writing, it’s rare to see a great weblog like this one nowadays.

  63. five diets

    5 October 2021 at 6:24 am

    Wow, awesome blog layout! How long have you been blogging
    for? you made blogging look easy. The overall
    look of your web site is wonderful, let alone the content!

    Also visit my blog: five diets

  64. https://prettypeople.club

    5 October 2021 at 6:27 am

    Hmm is anyone else having problems with the images on this blog loading?

    I’m trying to find out if its a problem on my end or if it’s the blog.
    Any feed-back would be greatly appreciated.

    My site … https://prettypeople.club

  65. improve skin care

    5 October 2021 at 6:36 am

    Outstanding post, I think people should acquire a lot from this weblog its very user friendly.
    So much wonderful info on here :D.

    Also visit my page: improve skin care

  66. http://habbonews10.altervista.org

    5 October 2021 at 6:43 am

    Some really interesting information, well written and broadly user
    friendly.

    Here is my web blog – http://habbonews10.altervista.org

  67. www.klnjudo.com

    5 October 2021 at 6:48 am

    If some one wants expert view about running a blog after that i propose him/her to go to see this weblog,
    Keep up the good job.

    My blog freshly hatched seeds, http://www.klnjudo.com,

  68. pain muscle problem

    5 October 2021 at 6:50 am

    If you want to take much from this post then you
    have to apply such strategies to your won web site.

    My site; pain muscle problem

  69. ravenhawksmagickalmysticalplaces.com

    5 October 2021 at 6:51 am

    I am continuously browsing online for tips that can aid me.
    Thank you!

    Here is my web site – ravenhawksmagickalmysticalplaces.com

  70. I feel this is among the most important info for me.
    And i’m glad studying your article. But wanna statement on few normal things, The website taste is
    perfect, the articles is truly excellent : D. Just right process, cheers

    My homepage … substance abuse treatment (https://community.rpgwriting.com/index.php?action=profile;u=358658)

  71. low-carb diet

    5 October 2021 at 6:55 am

    Hi there! I could have sworn I’ve been to this site before but after browsing through some of the post I realized it’s new to me.
    Anyhow, I’m definitely delighted I found it and I’ll be book-marking and checking back often!

    Also visit my web site low-carb diet

  72. Jude

    5 October 2021 at 7:03 am

    My spouse and I absolutely love your blog and find nearly all of your post’s to be
    just what I’m looking for. Does one offer guest writers to write content available for you?

    I wouldn’t mind composing a post or elaborating on a few of the subjects you write with regards to here.
    Again, awesome website!

  73. www.comptine.biz

    5 October 2021 at 7:10 am

    I want to express my love for your kind-heartedness supporting
    people that really need assistance with that subject matter.
    Your special commitment to passing the solution around turned out to be really insightful and have constantly permitted those much like me to arrive at their goals.

    Your personal helpful help and advice means a whole lot
    a person like me and further more to my colleagues.
    Many thanks; from everyone of us.

    My blog post – winter skin (http://www.comptine.biz)

  74. http://www.fotosombra.com.br

    5 October 2021 at 7:13 am

    I blog frequently and I seriously appreciate your content.
    Your article has truly peaked my interest. I am going to take a
    note of your website and keep checking for new information about once a week.
    I subscribed to your Feed too.

    Also visit my web site … facial skin care tips (http://www.fotosombra.com.br)

  75. sleep cycles

    5 October 2021 at 7:30 am

    Hello there! This post couldn?t be written much better!

    Going through this post reminds me of my previous roommate!

    He constantly kept preaching about this. I most certainly will send this post to
    him. Fairly certain he’ll have a great read. Thank you for sharing!

    my web-site … sleep cycles

  76. lost weight

    5 October 2021 at 7:31 am

    I couldn’t resist commenting. Exceptionally well written!

    Feel free to visit my web site … lost weight

  77. growing weed

    5 October 2021 at 7:32 am

    I likewise believe hence, perfectly written post!

    Look at my website; growing weed

  78. Hermelinda

    5 October 2021 at 7:33 am

    My brother suggested I might like this web site. He used to be totally right.
    This post truly made my day. You cann’t consider simply how so much
    time I had spent for this information! Thank you!

  79. low-carb diets popular

    5 October 2021 at 7:33 am

    Hey very interesting blog!

    Feel free to visit my web-site; low-carb diets popular

  80. healthy eating diets

    5 October 2021 at 7:42 am

    whoah this blog is wonderful i like reading your articles.
    Keep up the good work! You recognize, lots of individuals are searching around for this info,
    you could help them greatly.

    Feel free to visit my website – healthy eating diets

  81. make healthy eating

    5 October 2021 at 7:42 am

    Real fantastic info can be found on website.

    Also visit my web-site; make healthy eating

  82. Remarkable! Its really remarkable paragraph, I have got much clear idea regarding from this
    post.

    Also visit my webpage: http://www.fles.hlc.edu.tw/userinfo.php?uid=1376112

  83. https://xld-zm.com

    5 October 2021 at 7:45 am

    Just what I was looking for, thanks for posting.

    my webpage: https://xld-zm.com

  84. various low-carb diets

    5 October 2021 at 8:07 am

    I love your writing style truly enjoying this website.

    my page :: various low-carb diets

  85. Very nice article, totally what I was looking for.

    my webpage :: potato diet, https://ug-plast.ru/forum/index.php?action=profile;u=2005915,

  86. turn on a woman

    5 October 2021 at 8:16 am

    Hello there! Do you know if they make any plugins to help with Search Engine
    Optimization? I’m trying to get my blog to rank for some targeted keywords but I’m not seeing very
    good gains. If you know of any please share. Thank you!

    my blog: turn on a woman

  87. Renate

    5 October 2021 at 8:21 am

    Does your site have a contact page? I’m having a tough time
    locating it but, I’d like to shoot you an email. I’ve got
    some creative ideas for your blog you might be interested in hearing.
    Either way, great site and I look forward to seeing it grow over time.

  88. Chelsea

    5 October 2021 at 8:24 am

    You really make it seem so easy with your presentation but I in finding this topic to be actually something that
    I think I’d never understand. It sort of feels too complex and extremely huge for me.
    I’m taking a look forward to your next submit, I will try to get the cling
    of it!

  89. healthy eating tips

    5 October 2021 at 8:31 am

    What i do not understood is in fact how you are no longer really a lot more well-appreciated than you might be
    now. You’re so intelligent. You understand therefore significantly in relation to this topic,
    produced me in my view consider it from a lot of numerous angles.
    Its like men and women are not fascinated except
    it’s something to do with Girl gaga! Your own stuffs great.
    Always handle it up!

    my web page: healthy eating tips

  90. Very excellent visual appeal on this internet site, I’d rate it
    10.

    Feel free to visit my homepage :: https://www.kaiyun.net/bbs////////home.php?mod=space&uid=195849&do=profile

  91. winter skin

    5 October 2021 at 8:46 am

    Asking questions are truly fastidious thing if you are
    not understanding anything entirely, but this article gives good
    understanding even.

    Look at my web-site winter skin

  92. Lorenza

    5 October 2021 at 8:47 am

    Wow, incredible weblog structure! How lengthy have you ever been running a blog for?

    you made blogging look easy. The entire look of your site is
    magnificent, as neatly as the content!

  93. make healthy eating

    5 October 2021 at 8:58 am

    Ahaa, its good conversation on the topic of
    this piece of writing at this place at this blog, I have read all that, so at this time me also commenting at
    this place.

    Stop by my website – make healthy eating

  94. https://bbs.cnction.com/

    5 October 2021 at 9:01 am

    I have been absent for some time, but now I remember
    why I used to love this web site. Thank you,
    I’ll try and check back more often. How frequently you update your site?

    Here is my homepage: natural skin care (https://bbs.cnction.com/)

  95. 100% pure skin care

    5 October 2021 at 9:05 am

    Good day! I simply would like to give you a huge thumbs up
    for the excellent information you have got here on this post.
    I will be coming back to your site for more soon.

    my web-site – 100% pure skin care

  96. lovemaking ideas

    5 October 2021 at 9:09 am

    Keep functioning ,impressive job!

    Here is my blog post lovemaking ideas

  97. Isabelle

    5 October 2021 at 9:17 am

    We are a group of volunteers and opening a new scheme in our
    community. Your web site offered us with valuable information to work
    on. You’ve done a formidable job and our entire community will be thankful to you.

  98. lower belly

    5 October 2021 at 9:18 am

    We’re a bunch of volunteers and starting a new scheme in our community.
    Your website offered us with useful information to paintings on. You have performed an impressive activity
    and our entire group will be thankful to you.

    Also visit my web-site :: lower belly

  99. Good day very cool website!! Guy .. Beautiful ..
    Superb .. I will bookmark your blog and take the feeds also?
    I am happy to find numerous useful info right here within the post, we want work
    out more techniques on this regard, thank you for sharing.
    . . . . .

    my web-site … sexual health (http://www.fles.hlc.edu.tw/userinfo.php?uid=1374413)

  100. Hi, its fastidious post regarding media print, we all know media is a impressive source of facts.

    Also visit my web-site … teens smoking (http://www.a913.vip/forum.php?mod=viewthread&tid=2367630)

  101. consulenzaleonardo.com

    5 October 2021 at 9:28 am

    Excellent beat ! I would like to apprentice while you amend your website, how can i subscribe for
    a blog web site? The account aided me a acceptable deal.
    I had been a little bit acquainted of this your broadcast provided bright
    clear concept

    Here is my homepage – consulenzaleonardo.com

  102. www.fotosombra.com.br

    5 October 2021 at 9:32 am

    Why people still make use of to read news papers when in this technological globe all is existing on net?

    Feel free to surf to my webpage; http://www.fotosombra.com.br

  103. grow weed

    5 October 2021 at 9:32 am

    If some one desires to be updated with most recent technologies after that
    he must be pay a visit this website and be up to date every day.

    Have a look at my homepage; grow weed

  104. fast weight loss

    5 October 2021 at 9:36 am

    Hmm it appears like your site ate my first comment (it was extremely long) so I guess
    I’ll just sum it up what I submitted and say, I’m thoroughly enjoying your blog.

    I too am an aspiring blog blogger but I’m still new to the whole thing.
    Do you have any tips and hints for novice blog writers?
    I’d certainly appreciate it.

    My web page – fast weight loss

  105. quit smoking remedies

    5 October 2021 at 9:36 am

    Hi there everyone, it’s my first pay a visit at this website,
    and post is really fruitful in support of me, keep
    up posting these types of articles.

    Feel free to visit my blog post :: quit smoking remedies

  106. Kandis

    5 October 2021 at 9:38 am

    I got this site from my pal who informed me concerning this web page and at the moment this time I am visiting this website and reading very
    informative content at this time.

    Also visit my website; Kandis

  107. I was curious if you ever considered changing the structure of your site?
    Its very well written; I love what youve got to say.
    But maybe you could a little more in the way of content
    so people could connect with it better. Youve got an awful lot of text for only having
    one or two images. Maybe you could space it out better?

    my page http://forum.chrisricard.net/index.php?action=profile;u=66492

  108. daily acne skin care routine

    5 October 2021 at 9:58 am

    I went over this site and I believe you have a lot of good information, bookmarked (:
    .

    Feel free to visit my website … daily acne skin care routine

  109. www.comptine.biz

    5 October 2021 at 10:00 am

    Lovely blog! I am loving it!! Will come back again. I am bookmarking your feeds also

    Feel free to surf to my web-site … http://www.comptine.biz

  110. ketosis diet

    5 October 2021 at 10:21 am

    I relish, result in I found exactly what I was having a look for.
    You have ended my four day lengthy hunt! God Bless you man. Have
    a great day. Bye

    Here is my webpage – ketosis diet

  111. hatched seeds require

    5 October 2021 at 10:24 am

    Merely wanna comment that you have a very nice website, I
    the design and style it really stands out.

    Also visit my website; hatched seeds require

  112. I don’t even know the way I ended up here, but I thought this submit was good.
    I do not understand who you might be but definitely you are going to a famous blogger
    should you are not already. Cheers!

    Also visit my blog post … https://hyphon.net/forum.php?mod=viewthread&tid=53363

  113. carb cycling

    5 October 2021 at 10:37 am

    Normally I don’t read post on blogs, but I wish to say that
    this write-up very compelled me to try and do so! Your writing style has been surprised
    me. Thank you, very great post.

    my blog post; carb cycling

  114. http://www.fles.hlc.edu.tw/

    5 October 2021 at 10:37 am

    Thanks for all your efforts that you have put in this.
    Very interesting information.

    Look into my web site; http://www.fles.hlc.edu.tw/

  115. facial skin treatment

    5 October 2021 at 10:50 am

    Excellent beat ! I would like to apprentice at the same time as you amend your
    web site, how could i subscribe for a blog web site? The account aided me a appropriate deal.
    I had been tiny bit familiar of this your broadcast offered shiny transparent idea.

    Review my site – facial skin treatment

  116. appexium diet pill review

    5 October 2021 at 10:55 am

    Superb post however I was wondering if you could write a litte more on this subject?
    I’d be very thankful if you could elaborate a little bit more.
    Thanks!

    Also visit my site appexium diet pill review

  117. www.meteoritegarden.com

    5 October 2021 at 10:57 am

    Having read this I thought it was extremely informative.
    I appreciate you finding the time and effort to put this article together.
    I once again find myself personally spending way too much time both reading
    and posting comments. But so what, it was still worthwhile!

    Here is my web-site – http://www.meteoritegarden.com

  118. healthy eating habits

    5 October 2021 at 11:05 am

    As a Newbie, I am constantly exploring online for articles that can aid me.
    Thank you

    Here is my homepage; healthy eating habits

  119. sexually submissive

    5 October 2021 at 11:13 am

    Just what I was searching for, thanks for putting up.

    Here is my webpage sexually submissive

  120. dangers of a protein diet

    5 October 2021 at 11:21 am

    Wow, wonderful blog structure! How lengthy have you been blogging for?

    you made running a blog glance easy. The full look dangers of a protein diet your web site is excellent,
    let alone the content!

  121. hemp seed oil uses

    5 October 2021 at 11:22 am

    That is really attention-grabbing, You are an excessively professional blogger.
    I’ve joined your feed and stay up for looking for extra of your magnificent post.
    Also, I’ve shared your site in my social networks

    My web-site; hemp seed oil uses

  122. Jeannette

    5 October 2021 at 11:23 am

    I used to be able to find good advice from your articles.

  123. how to get healthy skin

    5 October 2021 at 11:39 am

    I absolutely love your blog and find the majority of your post’s how to get healthy skin be just what I’m looking for.

    Does one offer guest writers to write content for you?
    I wouldn’t mind publishing a post or elaborating on a lot of the
    subjects you write regarding here. Again, awesome web log!

  124. Darrel

    5 October 2021 at 11:40 am

    Hello my loved one! I wish to say that this post
    is amazing, nice written and come with almost all
    significant infos. I’d like to see more posts like
    this .

  125. increase testosterone levels

    5 October 2021 at 11:47 am

    It’s nearly impossible to find knowledgeable people about this topic,
    however, you seem like you know what you’re talking about!
    Thanks

    Feel free to surf to my blog post … increase testosterone levels

  126. quality focused diets

    5 October 2021 at 11:51 am

    But wanna remark that you have a very decent site, I enjoy
    the layout it actually stands out.

    Here is my page: quality focused diets

  127. teen weightloss

    5 October 2021 at 12:02 pm

    Hello.This article was really fascinating, especially because I was searching for thoughts on this matter last Saturday.

    Look into my page :: teen weightloss

  128. Darin

    5 October 2021 at 12:11 pm

    Keep up the good piece of work, I read few content on this
    web site and I think that your web site is real interesting and has got sets of great
    info.

    Visit my page carb nite, Darin,

  129. stampedblueprint.com

    5 October 2021 at 12:14 pm

    Hi it’s me, I am also visiting this site on a
    regular basis, this web page is genuinely nice and the visitors are genuinely sharing good thoughts.

    Also visit my site – stampedblueprint.com

  130. crash diets

    5 October 2021 at 12:18 pm

    I have been surfing online more than three hours today, yet I never found any interesting article like yours.
    It’s pretty worth enough for me. Personally, if all website owners and bloggers made good content as you did, the internet
    will be much more useful than ever before.

    My blog post … crash diets

  131. travel bag

    5 October 2021 at 12:32 pm

    Fabulous, what a website it is! This webpage provides useful information to us, keep it up.

    Here is my blog post: travel bag

  132. freshly hatched seeds

    5 October 2021 at 12:40 pm

    Undeniably believe that that you stated. Your favorite justification seemed
    to be at the internet the easiest factor to take
    into accout of. I say to you, I certainly get irked at the same
    time as people consider concerns that they just do not recognise about.
    You managed to hit the nail upon the highest as smartly as defined out the whole thing with
    no need side effect , other folks could take a signal. Will likely be back to get more.
    Thank you!

    my site: freshly hatched seeds

  133. www.hjzzj.com

    5 October 2021 at 12:46 pm

    Howdy! I could have sworn I’ve been to this site before but
    after going through some of the articles I realized it’s new
    to me. Anyhow, I’m definitely delighted I discovered it and I’ll be book-marking it and checking
    back frequently!

    Feel free to surf to my web site: http://www.hjzzj.com

  134. how to make a man come

    5 October 2021 at 12:48 pm

    Sweet blog! I found it while browsing on Yahoo News.

    Do you have any suggestions on how to make a man come to get listed in Yahoo News?

    I’ve been trying for a while but I never seem to get there!
    Appreciate it

  135. Hi there, just changed into alert to your blog thru Google, and
    found that it is really informative. I’m gonna be careful essential tips for skin care (http://www.comptine.biz/modules.php?name=Your_Account&op=userinfo&username=UrsulaNoth) brussels.
    I’ll appreciate in the event you proceed this in future.
    A lot of folks will probably be benefited from your writing.
    Cheers!

  136. lose fa

    5 October 2021 at 1:06 pm

    Wow that was strange. I just wrote an incredibly long comment
    but after I clicked submit my comment didn’t appear. Grrrr…
    well I’m not writing all that over again. Anyways, just wanted to say excellent blog!

    Feel free to visit my web page – lose fa

  137. ebmelectronics.com

    5 October 2021 at 1:07 pm

    You should take part in a contest for one of the best websites on the
    net. I am going to recommend this web site!

    Also visit my homepage: ebmelectronics.com

  138. http://www.fles.hlc.edu.tw

    5 October 2021 at 1:12 pm

    Hi there, its nice post regarding media print, we all be familiar with media is a great source
    of facts.

    Here is my web site … freshly hatched seeds (http://www.fles.hlc.edu.tw)

  139. better sex life

    5 October 2021 at 1:12 pm

    Undeniably believe that which you said. Your favorite justification seemed to
    be on the net the simplest factor to bear in mind of.
    I say to you, I definitely get annoyed at the same time as
    other people think about worries that they just do not
    recognize about. You managed to hit the nail upon the highest and also outlined out the entire thing without having side effect , other folks can take a signal.
    Will probably be back to get more. Thank you

    My web page … better sex life

  140. cyclical ketogenic

    5 October 2021 at 1:15 pm

    Aw, this was a very nice post. Finding the time and actual effort to create a really good article?

    but what can I say? I put things off a whole lot
    and don’t manage to get nearly anything done.

    Here is my homepage: cyclical ketogenic

  141. flat belly diets

    5 October 2021 at 1:19 pm

    Wow that was odd. I just wrote an really
    long comment but after I clicked submit my comment didn’t appear.
    Grrrr… well I’m not writing all that over again. Anyway, just wanted to say superb blog!

    Here is my web site … flat belly diets

  142. Lawanna

    5 October 2021 at 1:20 pm

    Hello! Quick question that’s completely off topic.
    Do you know how to make your site mobile friendly? My website looks weird when browsing from my iphone.
    I’m trying to find a theme or plugin that might be able to resolve this issue.
    If you have any suggestions, please share. Cheers!

  143. seeds exist

    5 October 2021 at 1:34 pm

    Rattling nice style and design and fantastic subject matter, nothing else we want :
    D.

    Also visit my page … seeds exist

  144. care tips honey

    5 October 2021 at 1:39 pm

    Hey are using WordPress for your blog platform? I’m new to the blog world but I’m
    trying to get started and create my own. Do you require any
    coding knowledge to make your own blog? Any help would be
    really appreciated!

    Also visit my web page: care tips honey

  145. Jon

    5 October 2021 at 1:43 pm

    Hello there I am so excited I found your weblog,
    I really found you by accident, while I was researching on Aol for something else, Anyways
    I am here now and would just like to say kudos for a tremendous post and
    a all round entertaining blog (I also love the theme/design), I don’t have time to look over it all at the moment but I have book-marked
    it and also added in your RSS feeds, so when I have time I will be back to read
    a great deal more, Please do keep up the superb work.

  146. testosterone level

    5 October 2021 at 1:57 pm

    May I simply just say what a relief to uncover somebody that really knows what
    they’re talking about on the web. You actually understand how to bring an issue to light and make it important.
    A lot more people must check this out and understand this side
    of your story. It’s surprising you’re not more popular since
    you certainly have the gift.

    Here is my web blog … testosterone level

  147. Lovely just what I was looking for. Thanks to the author for taking his clock time on this one.

    my blog … atkins diet weight loss protein based diet revolution diet plan surrounding atkins diet diet book

  148. Kenton

    5 October 2021 at 2:37 pm

    Pretty section of content. I just stumbled upon your site and in accession capital to assert that I get actually enjoyed account
    your blog posts. Any way I’ll be subscribing to your augment and even I achievement you access consistently
    quickly.

    Look into my blog post :: beautiful skin (Kenton)

  149. weight loss goals

    5 October 2021 at 2:44 pm

    Hello I am so delighted I found your website, I really
    found you by mistake, while I was researching
    on Askjeeve for something else, Nonetheless I am here now and would just like to say cheers for
    a incredible post and a all round exciting blog (I also love the theme/design), I don’t have
    time to read through it all at the moment but I have bookmarked it
    and also included your RSS feeds, so when I have time I will be back to
    read a great deal more, Please do keep up the excellent work.

    My blog – weight loss goals

  150. diet lacking

    5 October 2021 at 2:49 pm

    I loved up to you’ll receive performed right here.

    The comic strip is attractive, your authored subject matter stylish.
    however, you command get bought an shakiness
    over that you want be turning in the following. unwell for sure come further before again as exactly
    the similar nearly a lot incessantly inside of case you shield this increase.

    Take a look at my web blog … diet lacking

  151. cleveland clinic diet

    5 October 2021 at 3:01 pm

    Very clean site, regards for this post.

    Feel free to visit my web-site :: cleveland clinic diet

  152. foro.mecanicasa.es

    5 October 2021 at 3:05 pm

    I’m honored to obtain a call coming from a friend as soon as
    he uncovered the important recommendations shared on the site.

    Studying your blog publication is a real fantastic experience.
    Many thanks for thinking about readers at all
    like me, and I desire for you the best of achievements being a professional in this
    surface area.

    Feel free to surf to my homepage: foro.mecanicasa.es

  153. hemp farming

    5 October 2021 at 3:11 pm

    As the admin of this website is working, no uncertainty very quickly it will be renowned, due
    to its feature contents.

    Also visit my web-site hemp farming

  154. Mel

    5 October 2021 at 3:14 pm

    I blog often and I truly appreciate your content. This great article has truly peaked my interest.
    I will bookmark your site and keep checking for new information about once a week.
    I opted in for your RSS feed as well.

  155. Lyndon

    5 October 2021 at 3:18 pm

    excellent publish, very informative. I ponder why the other experts of this sector don’t understand
    this. You should proceed your writing. I am sure, you’ve
    a huge readers’ base already!

  156. basic skin care routine

    5 October 2021 at 3:20 pm

    I love your blog.. very nice colors & theme. Did you make this website yourself
    or did you hire someone to do it for you? Plz reply
    as I’m looking to design my own blog and would like
    to find out where u got this from. many thanks

    My website … basic skin care routine

  157. building diet plan

    5 October 2021 at 3:31 pm

    Nice read, I just passed this onto a friend who was doing some research on that.
    And he just bought me lunch because I found it for him smile So let me rephrase
    that: Thanks for lunch!

    Take a look at my homepage building diet plan

  158. 163.30.42.16

    5 October 2021 at 3:45 pm

    Everything said made a bunch of sense. But, consider this,
    what if you were to create a awesome post title? I ain’t saying
    your content is not good., but what if you added something that
    makes people want more? I mean Μη χτυπάς μια πόρτα
    που είναι για σένα κλειστή. – αναπνοές is a little boring.
    You should glance at Yahoo’s home page and note how they write news titles to grab
    people to click. You might add a related video or a pic or two to get readers excited about everything’ve written. Just my opinion, it
    could bring your blog a little livelier.

    My site :: 163.30.42.16

  159. www.fles.hlc.edu.tw

    5 October 2021 at 3:45 pm

    If you would like to increase your know-how simply keep visiting this site
    and be updated with the most up-to-date news posted here.

    Feel free to visit my blog: http://www.fles.hlc.edu.tw

  160. carb nite solution

    5 October 2021 at 4:00 pm

    It’s hard to come by well-informed people about this
    topic, however, you sound like you know what you’re talking about!
    Thanks

    Also visit my webpage … carb nite solution

  161. loss diet

    5 October 2021 at 4:05 pm

    Hello there, just became aware of your blog through Google, and found that it’s truly informative.

    I am going to watch out for brussels. I will appreciate
    if you continue this in future. Lots of people will
    be benefited from your writing. Cheers!

    Feel free to surf to my web-site loss diet

  162. testosterone booster

    5 October 2021 at 4:28 pm

    Hey, I think your blog might be having browser
    compatibility issues. When I look at your blog site in Firefox, it looks
    fine but when opening in Internet Explorer, it has some overlapping.
    I just wanted to give you a quick heads up! Other
    then that, wonderful blog!

    Feel free to surf to my blog post: testosterone booster

  163. free indoor growing

    5 October 2021 at 4:37 pm

    Very nice article, exactly what I was looking for.

    My web site; free indoor growing

  164. best skin care

    5 October 2021 at 4:46 pm

    I don’t even know how I finished up here, but I assumed this submit was good.
    I don’t understand who you’re but definitely you are going to a famous blogger for
    those who aren’t already 😉 Cheers!

    my web-site; best skin care

  165. hot marriage sex

    5 October 2021 at 5:05 pm

    Excellent site you have here.. It’s difficult to find high quality writing
    like yours these days. I honestly appreciate individuals like you!
    Take care!!

    My homepage hot marriage sex

  166. skin care

    5 October 2021 at 5:34 pm

    I’m curious to find out what blog system you have been using?
    I’m having some small security problems with my latest
    blog and I would like to find something more safe. Do you have any recommendations?

    My web page … skin care

  167. healthy food

    5 October 2021 at 5:58 pm

    Heya i am for the primary time here. I found this board and I to find It truly useful & it
    helped me out much. I hope to provide one thing again and help others like you helped me.

    My page … healthy food

  168. Gregorio

    5 October 2021 at 6:06 pm

    We’re a bunch of volunteers and opening a brand new scheme
    in our community. Your web site offered us with helpful information to work on. You’ve done an impressive job and our entire neighborhood
    will be grateful to you.

  169. male skin

    5 October 2021 at 6:28 pm

    My partner and I absolutely love your blog and find a
    lot of your post’s to be what precisely I’m looking for.
    can you offer guest writers to write content in your case?
    I wouldn’t mind creating a post or elaborating on many
    of the subjects you write in relation to here.
    Again, awesome web site!

    My site :: male skin

  170. sexy lingerie

    5 October 2021 at 7:35 pm

    Attractive part of content. I just stumbled upon your web site and in accession capital to say that I get in fact loved account your
    weblog posts. Anyway I will be subscribing for your feeds and
    even I achievement you get entry to constantly fast.

    My website; sexy lingerie

  171. Iola

    5 October 2021 at 7:38 pm

    Wow! This can be one particular of the most helpful blogs
    We’ve ever arrive across on this subject. Basically
    Wonderful. I am also a specialist in this topic so I can understand your effort.

    Feel free to surf to my blog … marketing online, Iola,

  172. boost male libido

    5 October 2021 at 8:19 pm

    It?s difficult to find experienced people on this subject, however, you seem like
    you know what you?re talking about! Thanks

    Here is my page boost male libido

  173. amazing weight loss

    5 October 2021 at 8:37 pm

    I like the valuable info you supply in your articles.

    I will bookmark your blog and take a look at again right here frequently.
    I am reasonably sure I’ll be informed plenty of new stuff proper here!
    Best of luck for the next!

    Here is my web site; amazing weight loss

  174. build muscle diet

    5 October 2021 at 10:43 pm

    Thank you for your whole labor on this web page. Kate delights in conducting research and it is
    simple to grasp why. My spouse and i notice all of the powerful method you present simple tricks through your blog
    and as well as invigorate participation from some other people about this area plus our child is always discovering a whole lot.

    Have fun with the rest of the year. You’re the one carrying out a very good job.

    My site … build muscle diet

  175. healthy body

    5 October 2021 at 11:38 pm

    Thank you a lot for sharing this with all folks you really
    realize what you’re speaking about! Bookmarked.
    Kindly additionally seek advice from my web site =).
    We will have a link trade agreement among us!

    My blog post :: healthy body

  176. Bertha

    6 October 2021 at 11:03 pm

    Hmm is anyone else experiencing problems with the pictures on this blog loading?
    I’m trying to determine if its a problem on my end or if it’s the blog.

    Any feedback would be greatly appreciated.

  177. houston junk car buyer

    3 May 2022 at 8:12 pm

    Wow! This blog looks just like my old one! It’s on a totally different topic but it has pretty much
    the same page layout and design. Wonderful choice of colors!

  178. mp3juice

    25 March 2023 at 9:58 am

    Thank you for this article. I would also like to state that it can end up being hard when you find yourself in school and merely starting out to initiate a long credit standing. There are many learners who are just trying to make it through and have a protracted or good credit history are often a difficult factor to have.

  179. I mastered more interesting things on this losing weight issue. 1 issue is a good nutrition is vital when dieting. A tremendous reduction in fast foods, sugary food items, fried foods, sugary foods, pork, and white colored flour products may perhaps be necessary. Keeping wastes harmful bacteria, and toxic compounds may prevent desired goals for losing weight. While a number of drugs temporarily solve the challenge, the horrible side effects are certainly not worth it, and they also never give more than a short-term solution. This can be a known incontrovertible fact that 95 of diet plans fail. Many thanks sharing your thinking on this website.JJ’s Ducted Gas Heating Repairs and Installation 162 Mitchell Rd, Lilydale VIC 3140 0412 531 821

  180. usb rechargeable water pump

    29 March 2023 at 10:09 pm

    A further issue is that video gaming has become one of the all-time most significant forms of entertainment for people of every age group. Kids have fun with video games, plus adults do, too. Your XBox 360 is amongst the favorite gaming systems for those who love to have a lot of video games available to them, plus who like to play live with some others all over the world. Thanks for sharing your thinking.

  181. kontol besar

    30 March 2023 at 1:26 am

    I have realized that car insurance businesses know the cars and trucks which are at risk of accidents along with risks. Additionally, these people know what types of cars are given to higher risk and also the higher risk they may have the higher the actual premium charge. Understanding the basic basics of car insurance will help you choose the right sort of insurance policy that will take care of your needs in case you get involved in any accident. Many thanks sharing your ideas with your blog.

  182. Fantastic website. A lot of useful information here. I?m sending it to some buddies ans also sharing in delicious. And certainly, thanks for your sweat!

  183. urine warmer

    30 March 2023 at 7:55 pm

    naturally like your website however you have to take a look at the spelling on several of your posts. Many of them are rife with spelling issues and I find it very troublesome to inform the truth then again I?ll surely come again again.

  184. drug test

    1 April 2023 at 9:41 am

    What I have seen in terms of personal computer memory is there are technical specs such as SDRAM, DDR and many others, that must match up the technical specs of the motherboard. If the pc’s motherboard is very current and there are no operating-system issues, modernizing the memory literally normally takes under one hour. It’s one of the easiest computer upgrade types of procedures one can imagine. Thanks for giving your ideas.

  185. urine warmer

    1 April 2023 at 9:54 am

    I have seen many useful points on your web site about pc’s. However, I have the thoughts and opinions that laptops are still not quite powerful sufficiently to be a sensible choice if you usually do things that require a great deal of power, including video croping and editing. But for world wide web surfing, statement processing, and majority of other prevalent computer work they are okay, provided you never mind your little friend screen size. Appreciate sharing your notions.

  186. p.u.s.h disposables

    2 April 2023 at 1:01 am

    I am not sure where you’re getting your info, but great topic. I needs to spend some time learning more or understanding more. Thanks for wonderful info I was looking for this information for my mission.

  187. affordable

    6 April 2023 at 11:58 pm

    Hello there, simply became aware of your blog thru Google, and located that it’s truly informative. I?m going to be careful for brussels. I?ll appreciate in the event you continue this in future. Numerous folks will likely be benefited from your writing. Cheers!

  188. efectuar la venta del negocio

    9 April 2023 at 1:06 pm

    I have not checked in here for some time as I thought it was getting boring, but the last few posts are good quality so I guess I?ll add you back to my everyday bloglist. You deserve it my friend 🙂

  189. point of sale systems for hair salons

    10 April 2023 at 9:28 pm

    Based on my study, after a property foreclosure home is sold at a sale, it is common for any borrower to be able to still have a remaining unpaid debt on the personal loan. There are many loan providers who make an effort to have all fees and liens repaid by the following buyer. On the other hand, depending on specific programs, regulations, and state regulations there may be several loans that aren’t easily handled through the transfer of lending products. Therefore, the obligation still falls on the customer that has had his or her property in foreclosure. Thank you for sharing your thinking on this blog site.

  190. 에볼루션카지노

    13 April 2023 at 3:02 am

    Wonderful work! This is the type of information that should be shared around the internet. Shame on Google for not positioning this post higher! Come on over and visit my web site . Thanks =)

  191. how to sell merchant services

    15 May 2023 at 8:28 am

    Throughout the awesome design of things you actually secure a B- with regard to effort. Where you misplaced me was in all the particulars. As as the maxim goes, the devil is in the details… And it could not be more accurate here. Having said that, allow me tell you precisely what did work. The article (parts of it) is actually rather engaging which is possibly the reason why I am making an effort to opine. I do not make it a regular habit of doing that. Secondly, although I can notice the jumps in reasoning you make, I am not really convinced of just how you seem to unite your points that produce your conclusion. For now I shall yield to your issue however wish in the foreseeable future you link the facts much better.

  192. WxxilliamNox

    31 May 2023 at 10:14 am

  193. start a credit card processing company

    17 September 2023 at 12:24 pm

    Good blog! I really love how it is simple on my eyes and the data are well written. I’m wondering how I could be notified when a new post has been made. I’ve subscribed to your RSS which must do the trick! Have a great day!

  194. first data ISO Program

    19 September 2023 at 8:40 am

    Great write-up, I am normal visitor of one?s web site, maintain up the excellent operate, and It is going to be a regular visitor for a long time.

  195. 인천출장안마

    20 September 2023 at 1:35 am

    Hello There. I found your blog using msn. This is a very well written article. I?ll be sure to bookmark it and come back to read more of your useful info. Thanks for the post. I will definitely return.

  196. Promotional products supplier china

    20 September 2023 at 6:39 am

    I am extremely impressed together with your writing talents and also with the layout to your weblog. Is this a paid topic or did you modify it your self? Either way keep up the nice high quality writing, it?s rare to look a great weblog like this one nowadays..

  197. fiserv iso partnership

    21 September 2023 at 6:47 am

    I am not certain the place you are getting your info, but good topic. I needs to spend a while studying much more or working out more. Thanks for wonderful info I used to be on the lookout for this information for my mission.

  198. Hiya! I know this is kinda off topic however , I’d figured I’d ask. Would you be interested in trading links or maybe guest authoring a blog article or vice-versa? My blog goes over a lot of the same subjects as yours and I believe we could greatly benefit from each other. If you happen to be interested feel free to shoot me an e-mail. I look forward to hearing from you! Terrific blog by the way!

  199. 출장마사지

    24 September 2023 at 8:27 pm

    Your unique approach to addressing challenging subjects is like a breath of fresh air. Your articles stand out with their clarity and grace, making them a pure joy to read. Your blog has now become my go-to source for insightful content.

  200. fortnite aimbot

    24 September 2023 at 9:01 pm

    Please let me know if you’re looking for a article author for your weblog. You have some really great posts and I feel I would be a good asset. If you ever want to take some of the load off, I’d really like to write some material for your blog in exchange for a link back to mine. Please send me an email if interested. Thanks!

  201. 출장마사지

    26 September 2023 at 2:05 am

    I’d like to express my heartfelt appreciation for this enlightening article. Your distinct perspective and meticulously researched content bring a fresh depth to the subject matter. It’s evident that you’ve invested a great deal of thought into this, and your ability to articulate complex ideas in such a clear and comprehensible manner is truly commendable. Thank you for generously sharing your knowledge and making the process of learning so enjoyable.

  202. 출장안마

    26 September 2023 at 3:49 am

    I couldn’t agree more with the insightful points you’ve articulated in this article. Your profound knowledge on the subject is evident, and your unique perspective adds an invaluable dimension to the discourse. This is a must-read for anyone interested in this topic.

  203. white label payment gateway

    26 September 2023 at 4:32 am

    I do like the way you have presented this specific difficulty plus it does offer us a lot of fodder for thought. Nevertheless, through what I have experienced, I only trust as other feed-back stack on that people today keep on point and not embark upon a tirade of some other news of the day. Yet, thank you for this exceptional piece and while I do not necessarily go along with this in totality, I value the perspective.

  204. mbncard iso agent program

    26 September 2023 at 9:33 am

    A few things i have often told people is that when searching for a good internet electronics retail outlet, there are a few factors that you have to take into account. First and foremost, you would like to make sure to choose a reputable and reliable shop that has enjoyed great evaluations and scores from other people and business sector experts. This will make sure that you are getting through with a well-known store that provides good service and aid to the patrons. Thanks for sharing your ideas on this blog.

  205. 출장안마

    26 September 2023 at 11:59 am

    Your positivity and enthusiasm are undeniably contagious! This article brightened my day and left me feeling inspired. Thank you for sharing your uplifting message and spreading positivity among your readers.

  206. 출장안마

    27 September 2023 at 8:13 am

    I couldn’t agree more with the insightful points you’ve made in this article. Your depth of knowledge on the subject is evident, and your unique perspective adds an invaluable layer to the discussion. This is a must-read for anyone interested in this topic.

  207. situs porno

    29 September 2023 at 12:22 am

    Aw, this was a very nice post. In concept I wish to put in writing like this additionally ? taking time and precise effort to make an excellent article? however what can I say? I procrastinate alot and by no means seem to get something done.

  208. Gunnar Park

    1 October 2023 at 4:04 pm

    Your attention to detail doesn’t go unnoticed.

  209. 출장안마

    1 October 2023 at 7:53 pm

    Your writing style effortlessly draws me in, and I find it nearly impossible to stop reading until I’ve reached the end of your articles. Your ability to make complex subjects engaging is indeed a rare gift. Thank you for sharing your expertise!

  210. strippers miami

    2 October 2023 at 11:06 am

    I used to be suggested this web site by my cousin. I am not sure whether this submit is written via him as no one else recognise such targeted approximately my difficulty. You’re wonderful! Thanks!

  211. Tapestry Wall Hanging

    4 October 2023 at 12:50 am

    http://www.factorytapestry.com is a Trusted Online Wall Hanging Tapestry Store. We are selling online art and decor since 2008, our digital business journey started in Australia. We sell 100 made-to-order quality printed soft fabric tapestry which are just too perfect for decor and gifting. We offer Up-to 50 OFF Storewide Sale across all the Wall Hanging Tapestries. We provide Fast Shipping USA, CAN, UK, EUR, AUS, NZ, ASIA and Worldwide Delivery across 100+ countries.

  212. start a merchant services company

    4 October 2023 at 8:46 am

    I would like to thnkx for the efforts you’ve put in writing this web site. I’m hoping the same high-grade web site post from you in the upcoming also. Actually your creative writing abilities has encouraged me to get my own site now. Actually the blogging is spreading its wings quickly. Your write up is a good example of it.

  213. Chaim Weaver

    5 October 2023 at 10:59 pm

    This was eye-opening. I never thought of it that way.

  214. 출장마사지

    7 October 2023 at 11:38 pm

    I’m continually impressed by your ability to dive deep into subjects with grace and clarity. Your articles are both informative and enjoyable to read, a rare combination. Your blog is a valuable resource, and I’m grateful for it.

  215. 제주출장안마

    7 October 2023 at 11:42 pm

    I want to express my appreciation for this insightful article. Your unique perspective and well-researched content bring a new depth to the subject matter. It’s clear you’ve put a lot of thought into this, and your ability to convey complex ideas in such a clear and understandable way is truly commendable. Thank you for sharing your knowledge and making learning enjoyable.

  216. starting a merchant services company

    10 October 2023 at 4:17 pm

    We’re a group of volunteers and opening a new scheme in our community. Your website offered us with valuable information to work on. You’ve done a formidable job and our entire community will be grateful to you.

  217. become an iso merchant services

    12 October 2023 at 12:30 pm

    Its such as you learn my thoughts! You seem to understand a lot approximately this, like you wrote the guide in it or something. I believe that you just could do with a few p.c. to pressure the message house a bit, however other than that, that is magnificent blog. A great read. I will certainly be back.

  218. fiserv ISO Program

    14 October 2023 at 3:05 am

    Wow that was strange. I just wrote an extremely long comment but after I clicked submit my comment didn’t appear. Grrrr… well I’m not writing all that over again. Regardless, just wanted to say excellent blog!

  219. Good post here. One thing I would really like to say is that most professional job areas consider the Bachelors Degree as the entry level standard for an online degree. While Associate Diplomas are a great way to get started, completing a person’s Bachelors opens many doorways to various jobs, there are numerous on-line Bachelor Diploma Programs available by institutions like The University of Phoenix, Intercontinental University Online and Kaplan. Another issue is that many brick and mortar institutions make available Online versions of their qualifications but normally for a extensively higher fee than the organizations that specialize in online qualification plans.

  220. Mummy tummy tuck Perth

    16 October 2023 at 5:24 am

    I do enjoy the way you have presented this specific difficulty plus it does indeed give me personally a lot of fodder for consideration. Nonetheless, through what I have personally seen, I just wish when the actual remarks pile on that people continue to be on point and not get started upon a soap box regarding some other news of the day. Yet, thank you for this outstanding piece and although I do not really concur with it in totality, I regard the point of view.

  221. btyr

    16 October 2023 at 3:30 pm

    fantastic put up, very informative. I’m wondering why the other experts of this sector don’t realize this. You must continue your writing. I am confident, you have a huge readers’ base already!

  222. 제주출장안마

    16 October 2023 at 8:32 pm

    I want to express my sincere appreciation for this enlightening article. Your unique perspective and well-researched content bring a fresh depth to the subject matter. It’s evident that you’ve invested considerable thought into this, and your ability to convey complex ideas in such a clear and understandable way is truly commendable. Thank you for generously sharing your knowledge and making the learning process enjoyable.

  223. btyr

    17 October 2023 at 4:37 pm

    Hello, i believe that i noticed you visited my website thus i came to ?go back the choose?.I’m trying to find issues to improve my web site!I guess its adequate to make use of some of your concepts!!

  224. Skin Treatment Uxbridge

    18 October 2023 at 3:28 pm

    I’ve really noticed that repairing credit activity should be conducted with techniques. If not, it’s possible you’ll find yourself causing harm to your positioning. In order to realize your aspirations in fixing your credit score you have to make sure that from this moment you pay your entire monthly fees promptly before their appointed date. It is significant on the grounds that by not necessarily accomplishing that area, all other activities that you will take to improve your credit rating will not be useful. Thanks for sharing your suggestions.

  225. 제주출장마사지

    19 October 2023 at 4:04 am

    Your blog has rapidly become my trusted source of inspiration and knowledge. I genuinely appreciate the effort you invest in crafting each article. Your dedication to delivering high-quality content is apparent, and I eagerly await every new post.

  226. 제주출장마사지

    20 October 2023 at 12:28 am

    Your positivity and enthusiasm are undeniably contagious! This article brightened my day and left me feeling inspired. Thank you for sharing your uplifting message and spreading positivity among your readers.

  227. 창원출장안마

    20 October 2023 at 12:40 am

    Your unique approach to addressing challenging subjects is like a breath of fresh air. Your articles stand out with their clarity and grace, making them a pure joy to read. Your blog has now become my go-to source for insightful content.

  228. pemudatogel

    20 October 2023 at 10:00 pm

    This webpage does not render correctly on my apple iphone – you might wanna try and repair that

  229. Explore the Horizon

    21 October 2023 at 9:39 am

    I’ve been absent for some time, but now I remember why I used to love this blog. Thank you, I will try and check back more frequently. How frequently you update your web site?

  230. 인천출장샵

    31 December 2023 at 10:45 pm

    Your passion and dedication to your craft radiate through every article. Your positive energy is infectious, and it’s evident that you genuinely care about your readers’ experience. Your blog brightens my day!

  231. 출장샵

    4 January 2024 at 10:12 pm

    Your blog is a true gem in the vast expanse of the online world. Your consistent delivery of high-quality content is truly commendable. Thank you for consistently going above and beyond in providing valuable insights. Keep up the fantastic work!

  232. 서울출장샵

    6 January 2024 at 7:51 am

    I just wanted to express how much I’ve learned from this article. Your meticulous research and clear explanations make the information accessible to all readers. It’s evident that you’re dedicated to providing valuable content.

  233. 인천출장샵

    6 January 2024 at 8:02 am

    I simply wanted to convey how much I’ve gleaned from this article. Your meticulous research and clear explanations make the information accessible to all readers. It’s abundantly clear that you’re committed to providing valuable content.

  234. 서울출장마사지

    6 January 2024 at 8:25 am

    Your enthusiasm for the subject matter radiates through every word of this article; it’s contagious! Your commitment to delivering valuable insights is greatly valued, and I eagerly anticipate more of your captivating content. Keep up the exceptional work!

  235. 서울출장마사지

    7 January 2024 at 12:23 pm

    Your positivity and enthusiasm are undeniably contagious! This article brightened my day and left me feeling inspired. Thank you for sharing your uplifting message and spreading positivity among your readers.

  236. 서울출장마사지

    7 January 2024 at 1:07 pm

    I’ve discovered a treasure trove of knowledge in your blog. Your unwavering dedication to offering trustworthy information is truly commendable. Each visit leaves me more enlightened, and I deeply appreciate your consistent reliability.

  237. 출장마사지

    8 January 2024 at 5:33 pm

    I couldn’t agree more with the insightful points you’ve made in this article. Your depth of knowledge on the subject is evident, and your unique perspective adds an invaluable layer to the discussion. This is a must-read for anyone interested in this topic.

  238. 인천출장마사지

    2 February 2024 at 7:22 am

    I must commend your talent for simplifying complex topics. Your ability to convey intricate ideas in such a relatable way is admirable. You’ve made learning enjoyable and accessible for many, and I appreciate that.

  239. 출장안마

    2 February 2024 at 7:45 am

    This article is a real game-changer! Your practical tips and well-thought-out suggestions are incredibly valuable. I can’t wait to put them into action. Thank you for not only sharing your expertise but also making it accessible and easy to implement.

  240. 출장샵

    24 February 2024 at 5:18 am

    Your positivity and enthusiasm are truly infectious! This article brightened my day and left me feeling inspired. Thank you for sharing your uplifting message and spreading positivity to your readers.

  241. 서울출장안마

    14 March 2024 at 6:47 am

    I am continually impressed by your ability to delve into subjects with grace and clarity. Your articles are both informative and enjoyable to read, a rare combination. Your blog is a valuable resource, and I am sincerely grateful for it.

  242. 서울출장마사지

    15 March 2024 at 7:59 am

    Your blog is a true gem in the vast expanse of the online world. Your consistent delivery of high-quality content is truly commendable. Thank you for consistently going above and beyond in providing valuable insights. Keep up the fantastic work!

Leave a Reply

Your email address will not be published.

feautured

Άντρα σε κάνουν οι πράξεις, όχι τα λόγια

Published

on

Μοιραστείτε το με τους φίλους σας

Γράφει ο Κωνσταντίνος Καρύδης

«Όλοι μαλάκες είναι».
Πόσο εύκολα έχουν ειπωθεί αυτές οι λέξεις. Πόσο μελάνι δεν χύθηκε, πόσες συζητήσεις έμειναν στη μέση μόνο και μόνο γιατί το συμπέρασμα ήταν το εξής ένα. «Όλοι μαλάκες είναι».

Συμφωνώ, υπάρχουν πολλών ειδών «μαλάκες». Αν, όμως, εσύ δεν μπορείς να ξεχωρίσεις το αγόρι απʾ τον άντρα, και τον άντρα απʾ το αρσενικό δε σου φταίει κανένας, είναι δικό σου θέμα και καθόλου δεν με ενδιαφέρει.

Κρύβεσαι πίσω από δύο αποσιωπητικά, βουτηγμένη μέσα στο δήθεν φεμινισμό σου και δεν καταλαβαίνεις πως ουσιαστικά κάνεις ζημιά μόνο σε εσένα.

Το αγόρι, ο άντρας ή το αρσενικό (αν και τα δυο τελευταία έχουν λίγο μπερδεμένο νόημα) υπάρχει πιθανότητα να μην πάψει ποτέ να έχει αυτή του την ιδιότητα μέχρι τέλους.

Υπάρχει, όμως, καλή μου, μια κατηγορία αγοριών τα οποία «μυρίζουν» από μακριά πως όταν τα μαλλιά τους ασπρίσουν, θα έχουν αποδείξει ότι είναι αρσενικά (κρατώντας το «αρσενικά» ως τον υπέρτατο χαρακτηρισμό σʾ έναν άντρα).
Θα ωριμάσει μέσα από τον αυτοσαρκασμό του και θα βάλει την εκτίμηση που έχει στη γυναίκα δίπλα του πάνω απʾ όλα.

Είναι αυτός ο άντρας που θα ήθελες να δεις δίπλα στην κόρη σου, εκείνος στον οποίο θα ήθελες να μοιάσει ο γιος σου.

Είναι αυτός που θα καταφέρει να σʾ ανεβάσει ψηλά χωρίς να έχει μπράτσα και κοιλιακούς. Ξέρει να ξεχωρίσει το γυναικάκι απʾ την γυναίκα και θα διυλίσει την κάθε σου ματιά.

Ξέρει τι θα πει ευγένεια, εκτίμηση και θα στη δείξει ακόμα και στον τρόπο που περπατάει δίπλα σου ή στον τρόπο που μιλάει για εσένα στους φίλους του.

Δεν πιστεύω να νομίζετε πως ακόμα κι αυτός ο τύπος άντρα δε θα κοιτάξει άλλη γυναίκα.
Φυσικά και θα κοιτάξει, μα το νόημα δεν είναι τι θα κοιτάξει, αλλά πού θα καταλήξει τελικά το βλέμμα του, γιατί πολύ απλά εκείνο ανήκει μόνο σʾ εσένα.

Τα υπόλοιπα απλά τα προσπερνά σαν την πρώτη ματιά που ρίχνει μπαίνοντας σʾ ένα bar προσπαθώντας να βρει ένα κενό τραπέζι να κάτσετε.
Αυτό είσαι για εκείνον, η ξεχωριστή, μοναδική γωνιά, το μοναδικό τραπέζι που ψάχνει να βρει για νʾ αράξει.

Για τον πραγματικό άντρα, το «σʾ ευχαριστώ» και το «συγγνώμη» είναι ένα σύνολο γραμμάτων τα οποία με μεγάλη ευκολία θα τα συντάξει στη σωστή σειρά, για να τους αποδώσει τις τιμές που τους αναλογούν και μαζί μʾ αυτά και σε εσένα.

Την αποδοχή σου την έχει γραμμένη στα παλαιότερα των υποδημάτων του, μιας κι αυτό που αναζητά είναι η εκτίμηση κι ο σεβασμός σου.
Θα αποζητήσει σʾ εσένα τη γνώμη σου, την άποψή σου κι όχι ένα κοριτσάκι που θα του ψελλίζει συνεχόμενα, φοβισμένα «ναι».

Απλώνει το χέρι του να σε κρατήσει, έτσι απλά, επειδή είναι ικανός να κάνει το απλό, σημαντικό.

Είσαι η ιδανική για εκείνον, όχι επειδή συμμορφώνεσαι με κάποια πρότυπα, αλλά επειδή δεν τον ενδιαφέρει το ιδανικό και δεν το ψάχνει. Ξέρει τον τρόπο να σε κάνει να νιώσεις ιδανική για εκείνον κι αυτό του αρκεί.

Είναι ο άντρας που δεν είναι όμορφος, αλλά θα σου αποδεικνύει καθημερινά πως μοναδικός σκοπός του είναι το να νιώθει όμορφος στα μάτια σου.

Ξέρει να ηγηθεί, και μέσα απʾ την ηγετική του υπόσταση θα καλύψει όλες σου τις ανασφάλειες, την ίδια στιγμή που στα μάτια σου θα αναζητά εκείνη που θα μείνει στα δύσκολα χωρίς πολλές φαμφάρες.

Να ξέρεις πως τα λόγια του είναι οι πράξεις του, αλλά ακόμα κι όταν τα χρησιμοποιεί, το κάνει για να μην ξεχνιέσαι, γιατί ξεχνιέστε, αγαπητή μου.

Είναι εκείνος που στο άκουσμά του θα ριγήσεις από πόθο, θα σε κάνει να τον ποθήσεις παίζοντας με το μυαλό σου κι όχι με το κορμί σου.

Στο τέλος της ημέρας, στο κρεβάτι σου, θα είναι αυτός που, κλείνοντας τα μάτια σου δίπλα του, θα σε κάνει να χαμογελάσεις με την εικόνα ενός γέρου γκριζομάλλη που σε πλησιάζει από πίσω κουτσαίνοντας, και σε παίρνει αγκαλιά, την ίδια στιγμή που φιλά τον ρυτιδιασμένο σου λαιμό.

Αυτός ο ίδιος που το πρωί δε θα ξεχάσεις ποτέ να τον αποχαιρετήσεις με μια καλημέρα και ένα φιλί.

www.loveletters.gr

What’s your Reaction?
+1
9
+1
0
+1
2
+1
0
+1
0
+1
2
+1
0

Μοιραστείτε το με τους φίλους σας
Continue Reading

feautured

Όσο αγαπάς τον εαυτό σου τόσο θα αγαπάς τους άλλους.

Published

on

Μοιραστείτε το με τους φίλους σας

Της Ανθής Κατερίνη.

Αποκτάς μεγαλύτερη αγάπη για τους άλλους όταν αρχίζεις να φροντίζεις τον εαυτό σου. Εάν θέλεις να τους αγαπήσεις και δεν μπορείς να το εκφράσεις, η ίδια αυτή δυσκολία υπάρχει στην σχέση σου με τον εαυτό σου. Και αν σήμερα θέλεις να τους πεις πόσο όμορφοι είναι, είναι γιατί τα λόγια και οι πράξεις σου δεν κατευθύνονται εχθρικά προς τον εαυτό σου όπως χθες. Από τις σωστές για σένα επιλογές απορρέει από μέσα σου η επιθυμία να σου πεις μπράβο και έτσι καταλήγεις να επιβραβεύεις την ύπαρξη των άλλων που υπάρχουν εκεί και στέκουν τόσο όμορφοι. Με ιδιαίτερη ομορφιά, με την φιλικότητα και τον αυθορμητισμό τους, με την επιμονή και την εργατικότητά τους, με το άγχος τους, με την ντροπαλότητά τους. Όλοι βλέπεις σου αρέσουν τέτοιες μέρες που έχεις φροντίσει τον εαυτό σου και όλους τους αγαπάς ακόμη και αν είναι τόσο διαφορετικοί μεταξύ τους. Αποτελούν πλευρές του εαυτού σου και τις αποδέχεσαι. Μα εάν κάποια έχεις αποκλείσει από την ταυτότητά σου και δεν την θεωρείς δική σου πλευρά καταβάθος την ζηλεύεις και την αποστρέφεσαι σαν ατελής άνθρωπος που είσαι, που δεν του αρέσει να τον βαραίνει μία αίσθηση κατωτερότητας. Γι’ αυτό δεν πρέπει να φοβάσαι να γίνεις όλα αυτά που έχεις αποκλείσει πως μπορείς να είσαι. Αυτό ήταν μέχρι χτες. Σήμερα μπορείς να επιλέξεις από την αρχή. Μια επιλογή σε κρατά και η ιδέα πως δεν ήταν τέτοια όμορφα πράγματα στο πεδίο των επιλογών σου.
Όσο αγαπάς τον εαυτό σου τόσο θα αγαπάς τους άλλους. Όσο πιο όμορφο σε βρίσκεις τόσο θα βλέπεις ομορφιά στους άλλους.
Σταμάτα τις πράξεις που σε οδηγούνε σε φαύλους κύκλους αρνητικών συναισθημάτων. Αν σε τρέφει αυτή η ρόδα που πάνω της τσουλάς και ταυτόχρονα στην άσφαλτο πατιέσαι, μάθε να μην φοβάσαι να μείνεις εκτεθειμένος με τον πόνο σου, αντί να τον καλύπτεις με σκουπίδια. Μάθε πως όταν σταματήσεις τα εφήμερα παυσίπονα τότε θα σε διδάξει ο πόνος σου. Πρέπει να τον κοιτάξεις και μια φορά στα μάτια. Να μην τον πνίγεις με μία κουβέρτα για να εξαφανιστεί. Αντιθέτως, να καλύψεις εσένα με την κουβέρτα αυτή, να ζεσταθείς και ό, τι άσχημο ,θα δεις, που θα φύγει σαν μικρόβιο που δεν μπόρεσε να επιζήσει μέσα σε έναν οργανισμό που οι στρατιώτες του πολέμησαν με τόλμη και δύναμη για την προστασία του παλατιού τους. Γύμνασε τους πολεμιστές της ψυχής σου και θα γίνεις ο καλύτερος προστάτης του εαυτού σου. Γιατί όσο και να μην θέλουμε να το παραδεχτούμε εάν κατηγορούμε κάποιον για το κακό που μας έκανε, στην πραγματικότητα κατηγορούμε εμάς που μας φερθήκαμε με τέτοια αναισθησία και δεν μας προστατέψαμε όπως μας άξιζε. Και τέτοια ντροπή πώς να την ξεχάσεις; Με το να κάνεις τον εαυτό σου να σε εμπιστευτεί ξανά. Να πιστέψει πως εάν αφεθεί χαλαρός στα χέρια σου δεν θα βρεθεί ξανά στο πάτωμα, αλλά θα είσαι εκεί να τον αφήσεις να πέσει απαλά μέσα στην τρυφερή σου χούφτα.

αναπνοές

Ανθή Κατερίνη

Κάθε φορά που χάνομαι ανάμεσα στον ρεαλισμό και τον ρομαντισμό, στην αισιοδοξία και την απαισιοδοξία παίζω με τις λέξεις για να με ανακαλύψω. Οι σκέψεις μου χορεύουν στάζοντας μελάνι και δεν ξέρεις ποτέ τι θα σχηματίσουν τα βήματά τους. Η αδυναμία μου είναι οι όμορφες ψυχές. Μυρωδιές, μουσικές, εικόνες χρωματίζουν την καθημερινότητα μου. Στόχος μου είναι η αυτοβελτίωση γι’ αυτό συχνά αλλάζω αφήνοντας πίσω ότι στέκεται εμπόδιο ανάμεσα σε μένα και τον εαυτό μου.

View All Posts
What’s your Reaction?
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0

Μοιραστείτε το με τους φίλους σας
Continue Reading

feautured

Η Ελλάδα πάντα από κάπου αιμορραγεί.

Published

on

Μοιραστείτε το με τους φίλους σας

Της Δικαίας Μαραβέλια.

Αγαπητέ μου Έλληνα, ξέρεις από τότε που η Ελλαδίτσα μας θυμάται τον εαυτό της, πάντα από κάπου αιμορραγεί.
Τραβάς εσύ από την μια, τραβούν οι υπόλοιποι από την άλλη και τώρα είναι η ώρα που χρειάζεται την καλύτερη περίθαλψη γιατί αιμορραγεί στο κέντρο της.
Οι αξίες μας, ο πολιτισμός μας, η ψυχή μας, εμείς οι ίδιοι αφήσαμε να μας τα πάρουν… και τώρα απαιτείς να στα επιστρέψουν. 
Φοβάσαι να πεις δημόσια, ότι φοβάσαι για τα παιδιά σου;
Ξέρεις φοβάμαι, που φοβάσαι. Φοβάμαι που νομίζεις ότι τα θέματα που απασχολούν ολόκληρο τον πλανήτη δεν σε απασχολούν.
Ναι ζούμε στην πιο ευλογημένη χώρα στο κόσμο, στην χώρα της δημοκρατίας, στην χώρα που κάνουμε ποστ μόνο, τις σοφίες των σοφών μας, χωρίς να γνωρίζουμε το βαθύτερο νόημα τους.
Φοβάμαι… αλλά είμαι αισιόδοξη. Για τα παιδιά ρε, για τα παιδιά μας!

αναπνοές

Δικαία Μαραβέλια

Η Δικαία Μαραβέλια ζει μόνιμα στη Σύμη.
Μεγαλωμένη και κανακεμένη, στα γόνατα του παπά Τάσου, με ιερή στιγμή αυτή που την τάϊζε γλυκό σταφύλι με τόση ευλάβεια, σαν να ήταν κοινωνία.
Τον έβλεπε πάντα να γράφει όταν δεν λειτουργούσε.
Τώρα έφτασε η ώρα να ακολουθήσει τα χνάρια του, συντροφιά με τους αγγέλους της.

View All Posts
What’s your Reaction?
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0
+1
0

Μοιραστείτε το με τους φίλους σας
Continue Reading

Trending